PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g38807.1.p
Common NameBRADI_3g38807, LOC100843675
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 320aa    MW: 34597.7 Da    PI: 5.7718
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g38807.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.12e-181663148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEde+l+++v+ +G g+W+  +r  g++R++k+c++rw +yl
  Bradi3g38807.1.p 16 KGPWTPEEDEKLLRYVQGHGHGSWRNLPRLAGLNRCGKSCRLRWTNYL 63
                      79********************************************97 PP

2Myb_DNA-binding47.54e-1569114148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg+++++E+  +++++  lG++ W++ a  ++ gRt++++k++w+++l
  Bradi3g38807.1.p  69 RGKFSQDEENTILHLHSILGNK-WSAMATQLP-GRTDNEIKNYWNTHL 114
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.2621167IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.9E-241466IPR009057Homeodomain-like
SMARTSM007176.0E-151565IPR001005SANT/Myb domain
SuperFamilySSF466893.02E-3015110IPR009057Homeodomain-like
PfamPF002491.3E-161663IPR001005SANT/Myb domain
CDDcd001673.87E-121863No hitNo description
Gene3DG3DSA:1.10.10.607.8E-2667119IPR009057Homeodomain-like
SMARTSM007172.2E-1468116IPR001005SANT/Myb domain
PROSITE profilePS5129419.19268118IPR017930Myb domain
PfamPF002495.2E-1469114IPR001005SANT/Myb domain
CDDcd001671.85E-1071114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MGRSPCCADE GGVLKKGPWT PEEDEKLLRY VQGHGHGSWR NLPRLAGLNR CGKSCRLRWT  60
NYLRPDIKRG KFSQDEENTI LHLHSILGNK WSAMATQLPG RTDNEIKNYW NTHLKKRLIR  120
NGFDPMTHRP RTDFFAFDAL PQLLALAALH QQHQQQLDPA SAQMQGTGNA NTDMAVLQQA  180
AKLQYLQCLL QSISSTTTSS AAPVSSVVDV AAISLGGAPA VSEAPVTVTI SEEAARDHQE  240
GLLLSSDLEL EMNYSCHGGG SLSSLPPLAD FSDGTVDDGR CSATASSGFG DGAGGGSSPL  300
TWPEFFFPDD DPFVVTDFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-29131181105C-Myb DNA-Binding Domain
1msf_C3e-29131181105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003572317.10.0PREDICTED: transcription factor MYB39-like
SwissprotQ8GWP05e-70MYB39_ARATH; Transcription factor MYB39
TrEMBLI1I8290.0I1I829_BRADI; Uncharacterized protein
STRINGBRADI3G38807.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112637132
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10280.11e-78myb domain protein 92